PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4BL_545A5716E.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 146aa    MW: 16723.9 Da    PI: 12.1841
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4BL_545A5716E.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.51.8e-191054247
                           SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                           g+W++eEd llv +v+q+G ++W+ I++ ++ gRt+k+c++rw + 
  Traes_4BL_545A5716E.1 10 GSWSPEEDALLVALVRQHGARRWSVISAGVP-GRTGKSCRLRWCNQ 54
                           89*****************************.***********985 PP

2Myb_DNA-binding52.79.5e-1763105347
                            SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            ++T++Ed l++ a  ++G++ W+ Iar ++ gRt++++k++w++ 
  Traes_4BL_545A5716E.1  63 PFTAQEDALIIAAQSRYGNK-WADIARLLP-GRTDNSVKNHWNSN 105
                            89******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.705159IPR017930Myb domain
SuperFamilySSF466892.02E-306102IPR009057Homeodomain-like
SMARTSM007171.1E-16857IPR001005SANT/Myb domain
PfamPF002491.6E-18954IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-251062IPR009057Homeodomain-like
CDDcd001676.42E-151153No hitNo description
SMARTSM007171.5E-1460108IPR001005SANT/Myb domain
PROSITE profilePS5129419.88860110IPR017930Myb domain
PfamPF002491.9E-1463105IPR001005SANT/Myb domain
CDDcd001672.70E-1163106No hitNo description
Gene3DG3DSA:1.10.10.601.5E-2163108IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MEVPVPIKTG SWSPEEDALL VALVRQHGAR RWSVISAGVP GRTGKSCRLR WCNQLSPAVQ  60
HRPFTAQEDA LIIAAQSRYG NKWADIARLL PGRTDNSVKN HWNSNLRRCQ XPRPWPPPPP  120
RVPPPPLPRR PDRPREPRRN SRNRSW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A8e-36101085103MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3741111e-138AK374111.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3054K02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002489094.17e-56hypothetical protein SORBIDRAFT_0088s002210
SwissprotQ9FDW14e-44MYB44_ARATH; Transcription factor MYB44
TrEMBLW5E3G83e-99W5E3G8_WHEAT; Uncharacterized protein
STRINGSb0088s002210.12e-55(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23290.13e-48myb domain protein 70
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]